Mouse Anti-Rhesus SYT2 Antibody (CBMOAB-59613FYA)
Cat: CBMOAB-59613FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO59613FYA |
Specificity | This antibody binds to Rhesus SYT2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. |
Product Overview | Mouse Anti-Rhesus SYT2 Antibody is a mouse antibody against SYT2. It can be used for SYT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Synaptotagmin-2; SYT2 |
UniProt ID | H9FA20 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: GKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK. |
See other products for " SYT2 "
CBMOAB-00242FYA | Mouse Anti-Zebrafish SYT2 Antibody (CBMOAB-00242FYA) |
CBMOAB-42058FYC | Mouse Anti-Arabidopsis SYT2 Antibody (CBMOAB-42058FYC) |
MO-AB-65752W | Mouse Anti-Marmoset SYT2 Antibody (MO-AB-65752W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry