AibGenesis™ Mouse Anti-taar3 Antibody (CBMOAB-59632FYA)


Cat: CBMOAB-59632FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59632FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO59632FYA 100 µg
MO-AB-21215R Monoclonal Cattle (Bos taurus) WB, ELISA MO21215R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO59632FYA
SpecificityThis antibody binds to Rhesus taar3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus taar3 Antibody is a mouse antibody against taar3. It can be used for taar3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTrace amine-associated receptor 3; taar3
UniProt IDD2X5R0
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MDLIYIPEDLSSCPKFVNKSCPPTNRSFHVRVIMYSVMTGAMIITIFGNLVIIVSISHFKQLHSPTNFLILSMATTDFLLGSVIMPYSMVRSVESCWYFGDGFCKFHTSFDMMLSLTSIFHLCSIAIDRFYAVCYPLYYTTRMTSSTIKRLLAFCWSVPALFSFGLVLSEANVSGMQSYKILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSKQHARVISHVPESTKGAVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPILILDLLVWLGYFNSTCNPLIHGFFYPWFQKVLKYIVSGKIFSSHSETANLFPEAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry