AibGenesis™ Mouse Anti-TAAR5 Antibody (CBMOAB-59638FYA)


Cat: CBMOAB-59638FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59638FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO59638FYA 100 µg
MO-AB-21216R Monoclonal Cattle (Bos taurus) WB, ELISA MO21216R 100 µg
MO-AB-22469W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22469W 100 µg
MO-AB-33604W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33604W 100 µg
MO-AB-65776W Monoclonal Marmoset WB, ELISA MO65776W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset
CloneMO59638FYA
SpecificityThis antibody binds to Rhesus TAAR5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TAAR5 Antibody is a mouse antibody against TAAR5. It can be used for TAAR5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTAAR5
UniProt IDF7ATS7
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: MRAVFIQGAEEHPEAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNLFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPATYTSFFLYTNVVETRLNQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSNSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLTLSQKLFSPQTRTVDLYQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry