AibGenesis™ Mouse Anti-TAS2R20 Antibody (CBMOAB-59745FYA)


Cat: CBMOAB-59745FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59745FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO59745FYA 100 µg
MO-AB-20668W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20668W 100 µg
MO-AB-65857W Monoclonal Marmoset WB, ELISA MO65857W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO59745FYA
SpecificityThis antibody binds to Rhesus TAS2R20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the taste receptor two family of class C G-protein coupled receptors. Receptors of this family have a short extracellular N-terminus, seven transmembrane helices, three extracellular loops and three intracellular loops, and an intracellular C-terminus. Members of this family are expressed in a subset of taste receptor cells, where they function in bitter taste reception, as well as in non-gustatory cells including those of the brain, reproductive organs, respiratory system, and gastrointestinal system. This gene maps to the taste receptor gene cluster on chromosome 12p13. (From NCBI)
Product OverviewMouse Anti-Rhesus TAS2R20 Antibody is a mouse antibody against TAS2R20. It can be used for TAS2R20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTaste receptor type 2; TAS2R20
UniProt IDF7HKJ9
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: MMSFLPIVFSILVVVAFVLGNFANGFIALINFIAWFKRQKISSADQIIAALAVSRVGLLWVIVLHWYATVLNPNSSSLKVRIFLSNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKVKSVVLGILSGALLFLVCDLVAENVYINVWTKEYERNITWKIKLRNATYLSNLIVVTLANLIPFTLTLISFLLLICSLCKHLKKMKLYGKGSQDPSTKIHIKALQTVTSFLILFAVYFLCLIVSFWNYKKQQKELVLILCQAIGIIYPSFHSFLLIWGNKKLKQNFLSILWQVTCWAKGQNLSTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry