AibGenesis™ Mouse Anti-TCEAL3 Antibody (CBMOAB-59884FYA)


Cat: CBMOAB-59884FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59884FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO59884FYA 100 µg
MO-AB-16188W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16188W 100 µg
MO-AB-65967W Monoclonal Marmoset WB, ELISA MO65967W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO59884FYA
SpecificityThis antibody binds to Rhesus TCEAL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. (From NCBI)
Product OverviewMouse Anti-Rhesus TCEAL3 Antibody is a mouse antibody against TCEAL3. It can be used for TCEAL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription elongation factor A protein-like 3; TCEAL3
UniProt IDH9FQJ2
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQGKSEGEGKPQGEGKPASQAKPESQLRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQKDLEDVPYV.
For Research Use Only | Not For Clinical Use.
Online Inquiry