AibGenesis™ Mouse Anti-TCEAL7 Antibody (CBMOAB-59889FYA)


Cat: CBMOAB-59889FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59889FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO59889FYA 100 µg
MO-AB-22166W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22166W 100 µg
MO-AB-29366H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29366C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO59889FYA
SpecificityThis antibody binds to Rhesus TCEAL7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TCEAL7 Antibody is a mouse antibody against TCEAL7. It can be used for TCEAL7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTCEAL7
UniProt IDF6V8X5
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: PADKRAVRACGQGKEELVDSQIAPSSPPLPFCLQVPGSVFTHIWGKKSRKLPRTELSRKQQQHHAKTLQRKRRKAKVQRAKEGGRTPLWRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry