AibGenesis™ Mouse Anti-TECRL Antibody (CBMOAB-59998FYA)


Cat: CBMOAB-59998FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59998FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO59998FYA 100 µg
Inquiry
MO-AB-21412R Monoclonal Cattle (Bos taurus) WB, ELISA MO21412R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO59998FYA
SpecificityThis antibody binds to Rhesus TECRL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a ubiquitin-like domain in the N-terminal region, three transmembrane segments and a C-terminal 3-oxo-5-alpha steroid 4-dehydrogenase domain. The protein belongs to the steroid 5-alpha reductase family. Mutations in this gene result in ventricular tachycardia, catecholaminergic polymorphic, 3. (From NCBI)
Product OverviewMouse Anti-Rhesus TECRL Antibody is a mouse antibody against TECRL. It can be used for TECRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTECRL
UniProt IDF7GF58
Protein RefseqThe length of the protein is 334 amino acids long.
The sequence is show below: MRNFHFLSKLVLSAGPLKPTPAVKHSKTTHFEIEILDAQTRKQICILDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQVSWTTVFLAEYTGPLLIYLLFYLRIPCIYDGKESARRLRHPVVHLACFCHCIHYIRYLLETLFVHKVSAGHTPLKNLITSCAFYWGFTSWIAYYINHPLYTPPSFGNRQITVSAINFLICEAGNHFINVMLSHPNHTGNNACFPSPNYNPFTWMFFLVSCPNYTYEIGSWISFTVMTQTLPVGIFTLLMSIQMSLWAQKKHKIYLRKFSSYIHRKSAMIPFIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry