AibGenesis™ Mouse Anti-TEX33 Antibody (CBMOAB-60067FYA)


Cat: CBMOAB-60067FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60067FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO60067FYA 100 µg
MO-AB-21450R Monoclonal Cattle (Bos taurus) WB, ELISA MO21450R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO60067FYA
SpecificityThis antibody binds to Rhesus TEX33.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTEX33 (Testis Expressed 33) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus TEX33 Antibody is a mouse antibody against TEX33. It can be used for TEX33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTEX33
UniProt IDF6VKL5
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MDPQSRSLKNGGSRSSSRENRATSGEGAQPCQGTDDVPSMGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDELVSEEQVAGSREEGLEGDMGLDTAFPSPETDTQYKLWSTRLPLNWALGVSSWYSTGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHRKNAMNLNLQKALEEKYGENSKSKSSKY.
For Research Use Only | Not For Clinical Use.
Online Inquiry