AibGenesis™ Mouse Anti-TEX35 Antibody (CBMOAB-60069FYA)


Cat: CBMOAB-60069FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60069FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO60069FYA 100 µg
MO-AB-21451R Monoclonal Cattle (Bos taurus) WB, ELISA MO21451R 100 µg
MO-AB-29412H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29412C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO60069FYA
SpecificityThis antibody binds to Rhesus TEX35.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTEX35 (Testis Expressed 35) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus TEX35 Antibody is a mouse antibody against TEX35. It can be used for TEX35 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTEX35
UniProt IDF7GY80
Protein RefseqThe length of the protein is 233 amino acids long.
The sequence is show below: MSAKRAELKKTHLSKNYKAVCLELKPEPTKTFDYKAVKQEGRFTKAGVTQDLKNELREVREELKEKMEEIKQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGAGGANGAPCALHKKTMAPQKKQGSLDPLHECGPCCEKCLLCALKNNYNQGRNLPSEASGLYKGGEEPVTTQPSVGHAAPAPKSQTEGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry