AibGenesis™ Mouse Anti-THAP10 Antibody (CBMOAB-60141FYA)


Cat: CBMOAB-60141FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60141FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO60141FYA 100 µg
MO-AB-21290W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21290W 100 µg
MO-AB-21515R Monoclonal Cattle (Bos taurus) WB, ELISA MO21515R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO60141FYA
SpecificityThis antibody binds to Rhesus THAP10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of proteins sharing an N-terminal Thanatos-associated domain. The Thanatos-associated domain contains a zinc finger signature similar to DNA-binding domains. This gene is part of a bidirectional gene pair on the long arm of chromosome 15 that is regulated by estrogen and may play a role in breast cancer. (From NCBI)
Product OverviewMouse Anti-Rhesus THAP10 Antibody is a mouse antibody against THAP10. It can be used for THAP10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP10
UniProt IDF6WVA5
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPASKGEEERDQAGRPDTGGELQAARHSENVPDAVSCTRPRAGKQAAASQITCENEVVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATTQTDELWSRASSLFDIYSSDSETDTDWDIKSEQSDLSYIAVQVKEETC.
For Research Use Only | Not For Clinical Use.
Online Inquiry