AibGenesis™ Mouse Anti-TMEM126B Antibody (CBMOAB-60426FYA)


Cat: CBMOAB-60426FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60426FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60426FYA 100 µg
MO-AB-20019W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20019W 100 µg
MO-AB-26399W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26399W 100 µg
MO-AB-29526H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29526C 100 µg
MO-AB-66364W Monoclonal Marmoset WB, ELISA MO66364W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO60426FYA
SpecificityThis antibody binds to Rhesus TMEM126B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial transmembrane protein which is a component of the mitochondrial complex I assembly complex. The encoded protein serves as an assembly factor that is required for formation of the membrane arm of the complex. It interacts with NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 13. Naturally occurring mutations in this gene are associated with isolated complex I deficiency. A pseudogene of this gene has been defined on chromosome 9. (From NCBI)
Product OverviewMouse Anti-Rhesus TMEM126B Antibody is a mouse antibody against TMEM126B. It can be used for TMEM126B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM126B
UniProt IDF6WC67
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MTASMHGQPSPSLEDAKLRRPMIIEIIEKNFDYLRKEMTPNIYQTTSFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTYKLLVIDPLYSENISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGGVLLHWIRLCQTQMKLMVIPLVFQTMFGILNGLYHYAIFEGTLEKTIHEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry