AibGenesis™ Mouse Anti-TMEM158 Antibody (CBMOAB-60479FYA)


Cat: CBMOAB-60479FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60479FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO60479FYA 100 µg
MO-AB-21794R Monoclonal Cattle (Bos taurus) WB, ELISA MO21794R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO60479FYA
SpecificityThis antibody binds to Rhesus TMEM158.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM158 Antibody is a mouse antibody against TMEM158. It can be used for TMEM158 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 158; TMEM158
UniProt IDH9FHH5
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: AYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASATA.
For Research Use Only | Not For Clinical Use.
Online Inquiry