AibGenesis™ Mouse Anti-TMEM221 Antibody (MO-AB-06593W)


Cat: MO-AB-06593W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06593W Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO06593W 100 µg
MO-AB-08533H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08533C 100 µg
MO-AB-29581H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29581C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO06593W
SpecificityThis antibody binds to Rhesus TMEM221.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM221 Antibody is a mouse antibody against TMEM221. It can be used for TMEM221 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane Protein 221
UniProt IDF7EKS9
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: VLVLGFTCLLLAALCGHLGAELARGPGPRSSIFVKFCGRRKKCLSLHLFICCSLSGHLSALSIYALLLFEIETGAAAASILGSGALVLVAVLTHTLLRAARATRRGLHELSPPSFEDDLTRPAEVSKASPRAQPQQGIHRRTPYSTSPEPGDPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry