AibGenesis™ Mouse Anti-TMEM42 Antibody (CBMOAB-60587FYA)


Cat: CBMOAB-60587FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60587FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60587FYA 100 µg
MO-AB-11835W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11835W 100 µg
MO-AB-21879R Monoclonal Cattle (Bos taurus) WB, ELISA MO21879R 100 µg
MO-AB-29612H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29612C 100 µg
MO-AB-66515W Monoclonal Marmoset WB, ELISA MO66515W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO60587FYA
SpecificityThis antibody binds to Rhesus TMEM42.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM42 Antibody is a mouse antibody against TMEM42. It can be used for TMEM42 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM42
UniProt IDF6PXV5
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: MAERPRPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLAFGSEVVSMGLCVLGIIVMASTNSLMWTFFSRGLSFSMSSAIASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGLTLIHRKLPPIWKPLPHKQQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry