Mouse Anti-Rhesus TNNI3K Antibody (CBMOAB-60781FYA)
Cat: CBMOAB-60781FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO60781FYA |
Specificity | This antibody binds to Rhesus TNNI3K. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that belongs to the MAP kinase kinase kinase (MAPKKK) family of protein kinases. The protein contains ankyrin repeat, protein kinase and serine-rich domains and is thought to play a role in cardiac physiology. |
Product Overview | Mouse Anti-Rhesus TNNI3K Antibody is a mouse antibody against TNNI3K. It can be used for TNNI3K detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serine/threonine-protein kinase TNNI3K; TNNI3K |
UniProt ID | H9FG74 |
Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: LKPAAAAADMAYHHIRPPIGYSIPKPVSSLLIRGWNACPEGRPEFSEVVTKLEECLCNIELMSPASSNSSGSLSP. |
See other products for " TNNI3K "
MO-AB-66647W | Mouse Anti-Marmoset TNNI3K Antibody (MO-AB-66647W) |
MO-AB-21988R | Mouse Anti-Cattle TNNI3K Antibody (MO-AB-21988R) |
CBMOAB-64129FYA | Mouse Anti-Zebrafish tnni3k Antibody (CBMOAB-64129FYA) |
MO-DKB-01155W | Rabbit Anti-TNNI3K Antibody (MO-DKB-01155W) |
MO-AB-06634W | Mouse Anti-Rhesus TNNI3K Antibody (MO-AB-06634W) |
MO-AB-30821R | Mouse Anti-Pig TNNI3K Antibody (MO-AB-30821R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry