AibGenesis™ Mouse Anti-TTC16 Antibody (CBMOAB-61423FYA)
Cat: CBMOAB-61423FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-61423FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) | WB, ELISA | MO61423FYA | 100 µg | ||
| MO-AB-06748W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06748W | 100 µg | ||
| MO-AB-22331R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22331R | 100 µg | ||
| MO-AB-29826H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29826C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) |
| Clone | MO61423FYA |
| Specificity | This antibody binds to Rhesus TTC16. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus TTC16 Antibody is a mouse antibody against TTC16. It can be used for TTC16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Tetratricopeptide repeat protein 16; TTC16 |
| UniProt ID | H9FK27 |
| Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: LQEFDGAVEDFLKVLDMVTEDQEDMVRQAQRQLLLTYNDFAVHCYRQGAYQEGVLLLNKALRDEQQEKGLYINRG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry