Mouse Anti-Rhesus TULP3 Antibody (MO-AB-06768W)
Cat: MO-AB-06768W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO06768W |
Specificity | This antibody binds to Rhesus TULP3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the tubby gene family of bipartite transcription factors. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved N-terminal transcription activation region and a conserved C-terminal DNA and phosphatidylinositol-phosphate binding region. The encoded protein binds to phosphoinositides in the plasma membrane via its C-terminal region and probably functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, for instance, induced by G-protein-coupled-receptor signaling. It plays an important role in neuronal development and function. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Product Overview | Mouse Anti-Rhesus TULP3 Antibody is a mouse antibody against TULP3. It can be used for TULP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tubby-related protein 3 isoform 1; TULP3 |
UniProt ID | H9EYT4 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MEASRCRLGPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRARDEQTPLVN. |
See other products for " tulp3 "
MO-AB-08825H | Mouse Anti-Frog tulp3 Antibody (MO-AB-08825H) |
MO-AB-10366Y | Mouse Anti-Rabbit TULP3 Antibody (MO-AB-10366Y) |
MO-AB-22410R | Mouse Anti-Cattle TULP3 Antibody (MO-AB-22410R) |
MO-AB-01835R | Mouse Anti-Medaka tulp3 Antibody (MO-AB-01835R) |
MO-AB-67181W | Mouse Anti-Marmoset TULP3 Antibody (MO-AB-67181W) |
MO-AB-08270W | Mouse Anti-Cat TULP3 Antibody (MO-AB-08270W) |
MO-AB-35912W | Mouse Anti-Ferret TULP3 Antibody (MO-AB-35912W) |
MO-AB-15667W | Mouse Anti-Chimpanzee TULP3 Antibody (MO-AB-15667W) |
CBMOAB-45400FYC | Mouse Anti-Arabidopsis TULP3 Antibody (CBMOAB-45400FYC) |
MO-AB-18105Y | Mouse Anti-Sheep TULP3 Antibody (MO-AB-18105Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry