Mouse Anti-Rhesus TULP3 Antibody (MO-AB-06768W)


Cat: MO-AB-06768W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO06768W
SpecificityThis antibody binds to Rhesus TULP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the tubby gene family of bipartite transcription factors. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved N-terminal transcription activation region and a conserved C-terminal DNA and phosphatidylinositol-phosphate binding region. The encoded protein binds to phosphoinositides in the plasma membrane via its C-terminal region and probably functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, for instance, induced by G-protein-coupled-receptor signaling. It plays an important role in neuronal development and function. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Rhesus TULP3 Antibody is a mouse antibody against TULP3. It can be used for TULP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTubby-related protein 3 isoform 1; TULP3
UniProt IDH9EYT4
Protein RefseqThe length of the protein is 73 amino acids long.
The sequence is show below: MEASRCRLGPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRARDEQTPLVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry