Mouse Anti-Rhesus UBP1 Antibody (CBMOAB-61728FYA)


Cat: CBMOAB-61728FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO61728FYA
SpecificityThis antibody binds to Rhesus UBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctions as a transcriptional activator in a promoter context-dependent manner. Modulates the placental expression of CYP11A1. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2 (By similarity). Involved in regulation of the alpha-globin gene in erythroid cells. Binds strongly to sequences around the HIV-1 initiation site and weakly over the TATA-box. Represses HIV-1 transcription by inhibiting the binding of TFIID to the TATA-box.
Product OverviewMouse Anti-Rhesus UBP1 Antibody is a mouse antibody against UBP1. It can be used for UBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUBP1; UBP1
UniProt IDA2D6D3
Protein RefseqThe length of the protein is 35 amino acids long.
The sequence is show below: SIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry