AibGenesis™ Mouse Anti-VEPH1 Antibody (CBMOAB-62071FYA)


Cat: CBMOAB-62071FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62071FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO62071FYA 100 µg
MO-AB-18656W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18656W 100 µg
MO-AB-67655W Monoclonal Marmoset WB, ELISA MO67655W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO62071FYA
SpecificityThis antibody binds to Rhesus VEPH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus VEPH1 Antibody is a mouse antibody against VEPH1. It can be used for VEPH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVEPH1
UniProt IDF6U8P8
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEICITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRGNKDLCRNMSNYLSLAAITKADLLADHTEVIVKSILQGMVQKLSLGTCFRRHLKVFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry