Mouse Anti-Rhesus VSX1 Antibody (CBMOAB-62171FYA)


Cat: CBMOAB-62171FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO62171FYA
SpecificityThis antibody binds to Rhesus VSX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described.
Product OverviewMouse Anti-Rhesus VSX1 Antibody is a mouse antibody against VSX1. It can be used for VSX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVSX1
UniProt IDF7BZN0
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: XRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPVPAGPGQGSGCEGPAAAPCLGPGLDHSSLARGALPLGLGLLCGFGTQQPTAARAPCLLLADVPFLPPRGPEPAAPQAPSRQPPALGRQKRSESVSTSDEDSPYEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSAEGGLLGSCAPWLLGMHKKSMGMIRKPGSEDKLAGLWGSDHFKEGSSQSESGPQRGSDKVSPEHGLEDVAIDLSSSARQETKKVHPGAGAQGGSNSMALEGPQPGKVGAI.
For Research Use Only | Not For Clinical Use.
Online Inquiry