Mouse Anti-ZDHHC15 Antibody (CBMOAB-62759FYA)
Cat: CBMOAB-62759FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-62759FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO62759FYA | 100 µg | ||
MO-AB-01722L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01722L | 100 µg | ||
MO-AB-01959R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01959R | 100 µg | ||
MO-AB-04851Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04851Y | 100 µg | ||
MO-AB-09013W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09013W | 100 µg | ||
MO-AB-10544Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10544Y | 100 µg | ||
MO-AB-18311Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18311Y | 100 µg | ||
MO-AB-22886W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22886W | 100 µg | ||
MO-AB-23153R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO23153R | 100 µg | ||
MO-AB-23907H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23907C | 100 µg | ||
MO-AB-31315R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31315R | 100 µg | ||
MO-AB-34115W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34115W | 100 µg | ||
MO-AB-36019W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO36019W | 100 µg | ||
MO-AB-42873W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42873W | 100 µg | ||
MO-AB-47120W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO47120W | 100 µg | ||
MO-AB-68182W | Monoclonal | Marmoset | WB, ELISA | MO68182W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO62759FYA |
Specificity | This antibody binds to Rhesus ZDHHC15. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Golgi apparatus; Endoplasmic reticulum; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Rhesus ZDHHC15 Antibody is a mouse antibody against ZDHHC15. It can be used for ZDHHC15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ZDHHC15 |
UniProt ID | F6UIZ6 |
Protein Refseq | The length of the protein is 143 amino acids long. The sequence is show below: MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLIFYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGGQFIQRQLERQLSKYLRKAKSYMFSN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry