Mouse Anti-ZDHHC15 Antibody (CBMOAB-62759FYA)


Cat: CBMOAB-62759FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62759FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO62759FYA 100 µg
MO-AB-01722L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01722L 100 µg
MO-AB-01959R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01959R 100 µg
MO-AB-04851Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04851Y 100 µg
MO-AB-09013W Monoclonal Cat (Felis catus) WB, ELISA MO09013W 100 µg
MO-AB-10544Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10544Y 100 µg
MO-AB-18311Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18311Y 100 µg
MO-AB-22886W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22886W 100 µg
MO-AB-23153R Monoclonal Cattle (Bos taurus) WB, ELISA MO23153R 100 µg
MO-AB-23907H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23907C 100 µg
MO-AB-31315R Monoclonal Pig (Sus scrofa) WB, ELISA MO31315R 100 µg
MO-AB-34115W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34115W 100 µg
MO-AB-36019W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO36019W 100 µg
MO-AB-42873W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42873W 100 µg
MO-AB-47120W Monoclonal Horse (Equus caballus) WB, ELISA MO47120W 100 µg
MO-AB-68182W Monoclonal Marmoset WB, ELISA MO68182W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO62759FYA
SpecificityThis antibody binds to Rhesus ZDHHC15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ZDHHC15 Antibody is a mouse antibody against ZDHHC15. It can be used for ZDHHC15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZDHHC15
UniProt IDF6UIZ6
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLIFYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGGQFIQRQLERQLSKYLRKAKSYMFSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry