AibGenesis™ Mouse Anti-ZNF132 Antibody (CBMOAB-62947FYA)


Cat: CBMOAB-62947FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62947FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO62947FYA 100 µg
MO-AB-12653W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12653W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO62947FYA
SpecificityThis antibody binds to Rhesus ZNF132.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF132 Antibody is a mouse antibody against ZNF132. It can be used for ZNF132 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF132
UniProt IDF6RIP8
Protein RefseqThe length of the protein is 707 amino acids long.
The sequence is show below: MALPSPQVPVGLPASLMGPAQHTSWPCGSAVPALKSLVTFEDVAVYFSQEEWELLDAAQRHLYHSVMLENLELVTSLGCWHGVEGEEAHPKQNISVEEVLPVRIPNADSSTKKANSCDMCGPFLKDILYLAEHQGTHCEEKPYPCGVCGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALMKSSKVHLSENPFTCREGGKVILDSQDLLQLQAVDSGQKPYSNLGQLPEVCTTQKLFKCSNCGKAFLKSSTLLSHLRTHSEETPFACPTGGNFLEEKSTLGNQKFHTAEIPSVCKECGKAFSHPSKLRKHQKFHTEVRYYECIACGKTFNHKLTFVHHQRSHSGERPYECSECGKAFSNRSHLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQVRPYECSQCGKSFSRSSALIQHWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHTGERPFECSDCGKAFGNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGEKPYECSECGKAFAHSSTLIEHWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYKCTECGKFFSRKSSLICHWRVHTGERPYECSECGRAFSSNSHLVRHQRVHTQERPYECIQCGKAFSERSTLVRHQKVHTRERTYECNQCGKLFSHLCNLAQHKKIHI.
For Research Use Only | Not For Clinical Use.
Online Inquiry