AibGenesis™ Mouse Anti-ZNF16 Antibody (CBMOAB-62973FYA)


Cat: CBMOAB-62973FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62973FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO62973FYA 100 µg
MO-AB-09503H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09503C 100 µg
MO-AB-21912W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21912W 100 µg
MO-AB-68340W Monoclonal Marmoset WB, ELISA MO68340W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO62973FYA
SpecificityThis antibody binds to Rhesus ZNF16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains multiple tandem zinc finger motifs. The encoded protein is involved in the differentiation of erythroid and megakaryocytic cells. This gene is located in a cluster of related genes on chromosome 8 encoding zinc finger proteins. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF16 Antibody is a mouse antibody against ZNF16. It can be used for ZNF16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF16; ZNF16
UniProt IDA2D6A6
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: VPTAESPLICNECGKTFQGNPDLIQHQIFHIGEASFMCNGCGKTFSQNSVLKSCHRSHMSEKACQCSECGKALRGCSDFSRHQSHHSSERPYMCNECGKAFSQNSSLKKHQKSHMSEKPYECNECGKAFRRSSNLIQHQRIHSGEKPYVCSECGKAFRRSSNLIKHHRTHTGEKPFECGECRKAFSQSAHLRKHQRVH.
For Research Use Only | Not For Clinical Use.
Online Inquiry