AibGenesis™ Mouse Anti-ZNF181 Antibody (CBMOAB-62990FYA)


Cat: CBMOAB-62990FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62990FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO62990FYA 100 µg
MO-AB-07092W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07092W 100 µg
MO-AB-23244R Monoclonal Cattle (Bos taurus) WB, ELISA MO23244R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO62990FYA
SpecificityThis antibody binds to Rhesus ZNF181.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionZNF181 (Zinc finger protein 181) belongs to the KraB-ZFP (Kruppel-associated box zinc finger protein) family and contains a canonical KRAB domain as well as a C2H2-type zinc finger motif. It is hypothesized to regulate cell proliferation, differentiation, or immune responses through DNA binding and the recruitment of epigenetic modification complexes, thereby contributing to gene silencing and chromatin remodeling.
Product OverviewMouse Anti-Rhesus ZNF181 Antibody is a mouse antibody against ZNF181. It can be used for ZNF181 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF181
UniProt IDF6S668
Protein RefseqThe length of the protein is 500 amino acids long.
The sequence is show below: MVEKKLSKGMIPDWESRWESKELSTKKDIYDEDSPQTVIIEKVVKQSYEFSNSKKNLEYIEKLEGKHGSQVEHFRPATLTFRESPTPDSIYTFHSKSTLFETQKISAEGNSHKYAILKKNLPKKSVVKNEKISGGKKLLNSSISGAAFHQSKSLTLHQTCNREKIYICSECGKAFGKQSILNRHWRIHTGEKPYECRECGKTFSHGSSLTRHLISHSGEKPYKCVECGKAFSHVSSLTNHQSTHTGEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYECRICGKAFIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPYECIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHNGGKPNNVVSVEKPLDHMNHYTCEKPYRRETI.
For Research Use Only | Not For Clinical Use.
Online Inquiry