AibGenesis™ Mouse Anti-ZNF300 Antibody (CBMOAB-63131FYA)


Cat: CBMOAB-63131FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63131FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO63131FYA 100 µg
Inquiry
MO-AB-07130W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07130W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO63131FYA
SpecificityThis antibody binds to Rhesus ZNF300.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator. The function of this protein is not yet known. Three transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF300 Antibody is a mouse antibody against ZNF300. It can be used for ZNF300 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF300
UniProt IDF7DX78
Protein RefseqThe length of the protein is 603 amino acids long.
The sequence is show below: LLLQGLVSFKDVAVDFTQEEWQQLDPAQRTLYRDVMLENYSHLVSMGYPVSKPDVISKLEQGEEPWIIKRDISNWIYPDEYQADGRQGKKSNLHNSQSCILGTVSFHHKILKGVTKDGSLCSILKVCQGDGQLQRILENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETGTSIQRFHKYDALKKNLKPNIDLPSCYKSNSRKKIDQSFGGGKSSSQSEPNSTLEKIHNGVIPFDDNQYGTVFRNTQSLIQYQNVETKEKTCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQLIIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHTVVKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry