AibGenesis™ Mouse Anti-ZNF391 Antibody (CBMOAB-63203FYA)


Cat: CBMOAB-63203FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63203FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO63203FYA 100 µg
MO-AB-23291R Monoclonal Cattle (Bos taurus) WB, ELISA MO23291R 100 µg
MO-AB-68469W Monoclonal Marmoset WB, ELISA MO68469W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO63203FYA
SpecificityThis antibody binds to Rhesus ZNF391.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF391 Antibody is a mouse antibody against ZNF391. It can be used for ZNF391 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 391; ZNF391
UniProt IDH9FG46
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: GDGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNKCEKAFSYQSDLLVHSRIHSGEKPFECNKCGKSFSRSTHLTEHQRTHTGEKPYECNECGKAFSRSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQERPYKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry