AibGenesis™ Mouse Anti-ZNF426 Antibody (CBMOAB-63233FYA)


Cat: CBMOAB-63233FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63233FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63233FYA 100 µg
MO-AB-11199W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11199W 100 µg
MO-AB-68483W Monoclonal Marmoset WB, ELISA MO68483W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63233FYA
SpecificityThis antibody binds to Rhesus ZNF426.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionKaposi's sarcoma-associated herpesvirus (KSHV) can be reactivated from latency by the viral protein RTA. The protein encoded by this gene is a zinc finger transcriptional repressor that interacts with RTA to modulate RTA-mediated reactivation of KSHV. While the encoded protein can repress KSHV reactivation, RTA can induce degradation of this protein through the ubiquitin-proteasome pathway to overcome the repression. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF426 Antibody is a mouse antibody against ZNF426. It can be used for ZNF426 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF426
UniProt IDF6U578
Protein RefseqThe length of the protein is 543 amino acids long.
The sequence is show below: GHYLSGDPVCLHEEKTPAGRIASDCLTGCYQDSVTFDDVAVDFTQEEWTLLDPTQRSLYSDVMLENYKNLATVGGQIIKPSLISWLEQEESRTVRGGVLQGWEMQLETQWSTLQQDSLTGQTSIGMQLEGKHNGGELCDCEQCGEVFSEHSCLKMHMRTQSTGSTHDCNQYGKDFLTLHEKTSTGEKFNQSEKIFSLTPNIVYQRTSTQEKSFGCSHCGKSFINDSYLQAHMRTHNGEKLYEWRDYGPGFIDSTSLSVLIETLNAKKPYKCKECGKGYRYPAYLSIHMRTHTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCKECGKAFTQYSGLSMHVRSHSGDKPYECKECGKSFLTSSRLIQHIRTHTGEKPFVCVECGKAFAVSSNLSGHLRTHTEEKACECKICGKVFGYPSCLNNHMRTHSAQKPYTCKECGKAFNYSTHLKIHMRIHTGEKPYECKQCGKAFSHSSSFQIHGRTHTGEKPYECKECGKAFTCSSSFRIHEKTHTEEKPYKCQQCGKAYSHPRSLRRHEQIH.
For Research Use Only | Not For Clinical Use.
Online Inquiry