AibGenesis™ Mouse Anti-ZNF561 Antibody (CBMOAB-63371FYA)


Cat: CBMOAB-63371FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63371FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63371FYA 100 µg
MO-AB-10713W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10713W 100 µg
MO-AB-68542W Monoclonal Marmoset WB, ELISA MO68542W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63371FYA
SpecificityThis antibody binds to Rhesus ZNF561.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF561 Antibody is a mouse antibody against ZNF561. It can be used for ZNF561 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF561
UniProt IDF6S9K8
Protein RefseqThe length of the protein is 478 amino acids long.
The sequence is show below: GFFSREPVCPFEEKTKAERMVEDYLANSYQVNRQWNEVSYILTFLEWALLDTTEKYLYRDVMLENYMNLASVEWEIQPRIKRSSFQQGFLKNQISSGIQMTRGYSGWKLCDCKNCGEVFSEQFCLKTHMRAHNGGNTSEGNCYGKDVLSVHKEASIGQELSKFNPCGKVFTLTPGLAVHLEVLNARQPYKCKECGKGFKYFASLDNHMGIHTDEKLCEFQECERAITPSSHLKQCVAVHTGKKSKKTKKYGKSFTNFSQLYAHVKTHKGEKSFECKECGRSFRNSSCLNDHIQIHTGIKPHKCTYCGKAFTRSTQLTEHVRTHTGIKPYECKECGQAFAQYSGLSIHIRSHSGKKPYQCKECGKAFTTSTSLIQHIRIHTGEKPYECVECGKTFITSSRRSKHLKTHSGEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKECGKAFAVSSRLSRHERIHTGEKPHECKSMSVTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry