AibGenesis™ Mouse Anti-ZNF562 Antibody (CBMOAB-63374FYA)


Cat: CBMOAB-63374FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63374FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO63374FYA 100 µg
MO-AB-23154W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23154W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO63374FYA
SpecificityThis antibody binds to Rhesus ZNF562.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF562 Antibody is a mouse antibody against ZNF562. It can be used for ZNF562 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF562
UniProt IDF6VZR6
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MVEDYLANSYQDSVTFDDVAVEFTPEEWVLLDTTQKYLYRDVMLENYMNLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRNYSGWKLCENCGEVFSEQFCLKTHMRAHNGGNTSEGNCYGKDVLSVHKEASVGQELSKFNPCGKVFTLTPGLAVHLEILNGRQPYKCKECGKGFKYFASLDNHMGIHIGEKLCEFQECERAITPSSHLKQCVTVHTGRKSEKTKNCGKSFTNFSQLSAHAKTHKGEKSFECKECGRSFRNSSSFNVHIQIHTGIKPHKCTECGKAFTRSTHLTQHVRTHTGIKPYECKECGQAFTQYTGLAIHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSSHRSKHLKTHSGER.
For Research Use Only | Not For Clinical Use.
Online Inquiry