AibGenesis™ Mouse Anti-ZNF575 Antibody (CBMOAB-63397FYA)


Cat: CBMOAB-63397FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63397FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO63397FYA 100 µg
MO-AB-19748W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19748W 100 µg
MO-AB-23335R Monoclonal Cattle (Bos taurus) WB, ELISA MO23335R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO63397FYA
SpecificityThis antibody binds to Rhesus ZNF575.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF575 Antibody is a mouse antibody against ZNF575. It can be used for ZNF575 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 575; ZNF575
UniProt IDH9FG94
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: QGPLQKPSQSAPGPTASASAPPRPRRRPPPQRPHRCPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAFSYPSKLAAHRLTHSGARPHPCPHCPKAFGHRSKLAAHLWTHAPTRPYPCPDCPKSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry