AibGenesis™ Mouse Anti-ZNF615 Antibody (CBMOAB-63437FYA)


Cat: CBMOAB-63437FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63437FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63437FYA 100 µg
MO-AB-07220W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07220W 100 µg
MO-AB-25399W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25399W 100 µg
MO-AB-68567W Monoclonal Marmoset WB, ELISA MO68567W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63437FYA
SpecificityThis antibody binds to Rhesus ZNF615.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF615 Antibody is a mouse antibody against ZNF615. It can be used for ZNF615 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF615
UniProt IDF6S8T7
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: QESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWITVAKIQNKNCPGIGKADSLLQEHSLNQRLLKSVQQCNGQNTLRNTVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGEIGSLERPRQADHLRSEVQDQPGRHGETLSLLKTHTKN.
For Research Use Only | Not For Clinical Use.
Online Inquiry