AibGenesis™ Mouse Anti-ZNF664 Antibody (CBMOAB-63493FYA)


Cat: CBMOAB-63493FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63493FYA Monoclonal Rhesus (Macaca mulatta), Guinea pig (Cavia porcellus), Marmoset WB, ELISA MO63493FYA 100 µg
MO-AB-42889W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42889W 100 µg
MO-AB-68585W Monoclonal Marmoset WB, ELISA MO68585W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Guinea pig (Cavia porcellus), Marmoset
CloneMO63493FYA
SpecificityThis antibody binds to Rhesus ZNF664.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF664 Antibody is a mouse antibody against ZNF664. It can be used for ZNF664 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 664; ZNF664
UniProt IDH9F5T9
Protein RefseqThe length of the protein is 77 amino acids long.
The sequence is show below: SLCIHQRVHTGEKPYRCCGCGKAFRQSSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry