AibGenesis™ Mouse Anti-ZNF674 Antibody (CBMOAB-63505FYA)


Cat: CBMOAB-63505FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63505FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO63505FYA 100 µg
MO-AB-07237W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07237W 100 µg
MO-AB-23353R Monoclonal Cattle (Bos taurus) WB, ELISA MO23353R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO63505FYA
SpecificityThis antibody binds to Rhesus ZNF674.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc finger protein with an N-terminal Kruppel-associated box-containing (KRAB) domain and 11 Kruppel-type C2H2 zinc finger domains. Like other zinc finger proteins, this gene may function as a transcription factor. This gene resides on an area of chromosome X that has been implicated in nonsyndromic X-linked cognitive disabilities. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF674 Antibody is a mouse antibody against ZNF674. It can be used for ZNF674 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF674
UniProt IDF7B345
Protein RefseqThe length of the protein is 487 amino acids long.
The sequence is show below: TDHYKESQDKLLWQAAFTVKETLKDESGQECKICRKIVYLNTDFVSVKQRLPKYYSWERCSKHNLNFLSQNRSYIRKKDDGCKAYWKVCLHSNLHKAQPADKFFDPNQQGKALHQKRALNKNQRSQTGEKLYKCTECGKVFIQKANLVVHQRTHTGEKPYECCECAKAFSQKSTLVAHQRIHSGEKPYECSECGKTFIQKSTLIKHQRTHTGEKPFVCGKCPKAFKSSYHLIRHEKTHIRQAFYKGIRCTKSNLIYQRIHTSKKPEHSEHGKASDKKPSPTKHWRTHTKENIYECSKCGKSFRGKSHLSVHQRIHTGEKPYECNICGKTFSGKSHLSVHHRTHTGEKPYECRRCGKAFGEKSTLIVHQRMHTGEKPYKCNECGKAFSEKSPLIKHQRIHTGERPYECTDCKKAFSRKSTLIKHQRIHTGEKPYKCSECGKAFSVKSTLIVHHRTHTGEKPYECRDCGKAFSGKSTLIKHQRSHTGDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry