AibGenesis™ Mouse Anti-ZNF684 Antibody (CBMOAB-63525FYA)


Cat: CBMOAB-63525FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63525FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63525FYA 100 µg
MO-AB-07245W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07245W 100 µg
MO-AB-18904W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18904W 100 µg
MO-AB-68591W Monoclonal Marmoset WB, ELISA MO68591W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63525FYA
SpecificityThis antibody binds to Rhesus ZNF684.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF684 Antibody is a mouse antibody against ZNF684. It can be used for ZNF684 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF684
UniProt IDF7FR85
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: VLLQESVTFQDVAVDFTAEEWQLLDCTERTLYWDVMLENYRNLISVGCPINKTKVILKVEQGQEPWMVEGVNLHQSSPGCSAVVQSQLGFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry