AibGenesis™ Mouse Anti-rhoaa Antibody (CBMOAB-95917FYA)


Cat: CBMOAB-95917FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95917FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95917FYA 100 µg
MO-DKB-00121W Polyclonal Zebrafish (Danio rerio) ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO95917FYA
SpecificityThis antibody binds to Zebrafish rhoaa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish rhoaa Antibody is a mouse antibody against rhoaa. It can be used for rhoaa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRas homolog gene family, member Aa; Ras-like protein Rhoaa; rhoa
UniProt IDQ6NUX8
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQAKKRGKKNACALL.
For Research Use Only | Not For Clinical Use.
Online Inquiry