AibGenesis™ Mouse Anti-rhov Antibody (CBMOAB-95954FYA)


Cat: CBMOAB-95954FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95954FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO95954FYA 100 µg
MO-AB-07118H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07118C 100 µg
MO-AB-17485Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17485Y 100 µg
MO-AB-19284R Monoclonal Cattle (Bos taurus) WB, ELISA MO19284R 100 µg
MO-AB-28490H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28490C 100 µg
MO-AB-63302W Monoclonal Marmoset WB, ELISA MO63302W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO95954FYA
SpecificityThis antibody binds to Zebrafish rhov.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rhov Antibody is a mouse antibody against rhov. It can be used for rhov detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNovel protein similar to vertebrate ras homolog gene family, member V; RHOV; Ras family GTPase; Ras homolog gene family, member V; rhov; chp OTTDARP0000000702
UniProt IDQ5YLG6
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MPPQMDYFYHESRVPSVCLEQDEELLEPAISCMLVGDGAVGKTSMIVSYTTNGYPTDYKQTAFDVFSGQVQVDGTPVRIQLMDTAGQEEFDEFRSLSYAHTDVFLLCFSVVNPTSFQNITKKWIPEIRECNPSSPIILVGTQSDLVLDVNVLIDLDRYKVKPVCSSRARSLSEKIRAAEYVECSALTQKNLKEAFDAAIFAAIKHKARKAKKRRLSDRRTKAFSKCSWKKFFCFI.
For Research Use Only | Not For Clinical Use.
Online Inquiry