Cat: CBMOAB-18463FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rice (Oryza) |
| Clone | MO18463FYB |
| Specificity | This antibody binds to Rice ACBP. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rice ACBP (clone MO18463FYB) Antibody (CBMOAB-18463FYB) is a mouse antibody against ACBP. It can be used for ACBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acyl-CoA-binding protein; ACBP |
| UniProt ID | Q8L823 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MGLQEDFEQYAEKGRPCRRALATRTSLSSMDSTSRPPLEMSILLVLAYSPRGTGRNGMHGKLLKANRRRKQLSDYITKVKQLLEEACCLQLL. |
See other products for " ACBP "
| MO-AB-00013H | Mouse Anti-Arabidopsis ACBP Antibody (MO-AB-00013H) |
| MO-AB-38809W | Mouse Anti-Grape ACBP Antibody (MO-AB-38809W) |
| MO-AB-10598Y | Mouse Anti-O. mykiss ACBP Antibody (MO-AB-10598Y) |
| MO-AB-10597Y | Mouse Anti-O. mykiss ACBP Antibody (MO-AB-10597Y) |
For Research Use Only | Not For Clinical Use.