Mouse Anti-Rice ADF4 Antibody (CBMOAB-18496FYB)


Cat: CBMOAB-18496FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18496FYB
SpecificityThis antibody binds to Rice ADF4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (By similarity). Involved in innate immunity. Required for the expression of defense-related genes PR1A, LOX2 and CHS1 upon biotic stresses. Required for basal resistance to the fungal blast (Magnaporthe grisea), bacterial blight (Xanthomonas oryzae pv. oryzae, Xoo) and the herbivorous insect brown planthopper (Nilaparvata lugens, BPH). Involved in the promotion of seed germination. Required for the expression of alpha-amylase genes during seed germination (PubMed:24033867).
Product OverviewMouse Anti-Rice ADF4 (clone MO18496FYB) Antibody (CBMOAB-18496FYB) is a mouse antibody against ADF4. It can be used for ADF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin-depolymerizing factor 4; ADF-4; OsADF4; ADF4; Os03g0820600 LOC_Os03g60590
UniProt IDQ84TB3
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MANSSSGVAIHDDCKLKFNELQSKRMHRFITFMMDNKGKEIIVDKIGDRTTSYEDFTSSLPEGDCRFAIYDFDFLTAEDVPKSRIFYILWSPDNAKVRSKMLYASSNERFKKELNGIQLEVQATDAGEISLDALKDRVK.

See other products for " ADF4 "

For Research Use Only | Not For Clinical Use.

Online Inquiry