Mouse Anti-Rice BZR1 Antibody (CBMOAB-21994FYB)


Cat: CBMOAB-21994FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO21994FYB
SpecificityThis antibody binds to Rice BZR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPositive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626).
Product OverviewMouse Anti-Rice BZR1 Antibody is a mouse antibody against BZR1. It can be used for BZR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein BZR1 homolog 1; OsBZR1; Protein BRASSINAZOLE-RESISTANT 1 homolog 1; BZR1; Os07g0580500 LOC_Os07g39220
UniProt IDQ7XI96
Protein RefseqThe length of the protein is 298 amino acids long.
The sequence is show below: MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK.
See other products for " BZR1 "
MO-MMB-0065Rabbit Anti-BZR1 Antibody (Cat MO-MMB-0065)
MO-DKB-04000WRabbit Anti-BZR1 Antibody (Cat MO-DKB-04000W)
MO-DKB-03787WRabbit Anti-BZR1 Antibody (Cat MO-DKB-03787W)
MOFAB-622WMouse Anti-Rice subsp. japonica BZR1 Antibody (MOFAB-622W)
MO-DKB-0572RARabbit Anti-BZR1 Antibody (MO-DKB-0572RA)
MOFAB-199WRabbit Anti-BZR1 Antibody (MOFAB-199W)
CBMOAB-25565FYCMouse Anti-Arabidopsis BZR1 Antibody (CBMOAB-25565FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry