Mouse Anti-Rice cox1 Antibody (CBMOAB-22313FYB)


Cat: CBMOAB-22313FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO22313FYB
SpecificityThis antibody binds to Rice cox1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Product OverviewMouse Anti-Rice cox1 Antibody is a mouse antibody against cox1. It can be used for cox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 1; EC 1.9.3.1; cox1
UniProt IDQ7JAI6
Protein RefseqThe length of the protein is 524 amino acids long.
The sequence is show below: MTNLVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGFGNWFVPILIGAPDMAFPRLNNISFWLLPPSLLLLLSSALVEVGSGTGWTVYPPLSGITSHSGGAVDLAIFSLHLSGVSSILGSINFITTIFNMRGPGMTMHRLPLFVWSVLVTAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHIVSTFSRKPVFGYLGMVYAMISIGVLGFLVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKIFSWIATMWGGSIQYKTPMLFAVGFIFLFTIGGLTGIVLANSGLDIALHDTYYVVAHFHYVLSMGAVFALFAGFYYWVGKIFGRTYPETLGQIHFWITFFGVNLTFFPMHFLGLSGMPRRIPDYPDAYAGWNALSSFGSYISVVGIRRFFVVVAITSSSGKNKRCAESPWAVEQNPTTLEWLVQSPPAFHTFGELPAIKETKS.
See other products for " COX1 "
CBMOAB-26448FYCMouse Anti-Arabidopsis COX1 Antibody (CBMOAB-26448FYC)
MO-AB-38508WMouse Anti-Gorilla COX1 Antibody (MO-AB-38508W)
MO-AB-36944WMouse Anti-Goat COX1 Antibody (MO-AB-36944W)
CBMOAB-02103HCBMouse Anti-C. elegans COX1 Antibody (CBMOAB-02103HCB)
MO-AB-14695YMouse Anti-Sheep COX1 Antibody (MO-AB-14695Y)
MO-AB-01374YMouse Anti-Chicken COX1 Antibody (MO-AB-01374Y)
MO-AB-17352WMouse Anti-Chimpanzee COX1 Antibody (MO-AB-17352W)
MO-DKB-02053WRabbit Anti-COX1 Antibody (MO-DKB-02053W)
MO-AB-32986HMouse Anti-Nile tilapia COX1 Antibody (MO-AB-32986H)
MO-AB-29774WMouse Anti-Dog COX1 Antibody (MO-AB-29774W)
For Research Use Only | Not For Clinical Use.
Online Inquiry