AibGenesis™ Mouse Anti-LEA3 Antibody (CBMOAB-23412FYB)


Cat: CBMOAB-23412FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23412FYB Monoclonal Rice (Oryza), French-bean WB, ELISA MO23412FYB 100 µg
MO-AB-36262W Monoclonal French-bean WB, ELISA MO36262W 100 µg
MO-DKB-0590RA Polyclonal Rice (Oryza) WB 50 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), French-bean
CloneMO23412FYB
SpecificityThis antibody binds to Rice LEA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice LEA3 Antibody is a mouse antibody against LEA3. It can be used for LEA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLate embryogenesis abundant protein, group 3; LEA-3; LEA3; LEA; Os05g0542500 LOC_Os05g46480
UniProt IDP0C5A4
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MASHQDQASYRAGETKAHTEEKAGQVMGASKDKASEAKDRASEAAGHAAGKGQDTKEATKEKAQAAKERASETAQAAKDKTSSTSQAARDKAAESKDQTGGFLGEKTEQAKQKAAETAGAAKQKTAETAQYTKDSAIAGKDKTGSVLQQASEQVKSTVVGAKDAVMSTLGMTEDEAGTDDGANKDTSATAAATETTARDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry