AibGenesis™ Mouse Anti-MADS16 Antibody (CBMOAB-34563FYB)


Cat: CBMOAB-34563FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34563FYB Monoclonal Rice (Oryza), Rice WB, ELISA MO34563FYB 100 µg
Inquiry
MO-MMB-0181 Polyclonal Rice ELISA, WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Rice
CloneMO34563FYB
SpecificityThis antibody binds to Rice MADS16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice MADS16 Antibody is a mouse antibody against MADS16. It can be used for MADS16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMADS-box transcription factor 16; OsMADS16; Protein APETALA3-like; Protein SUPERWOMAN1; MADS16; SPW1; Os06g0712700 LOC_Os06g49840
UniProt IDQ944S9
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MGRGKIEIKRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCSPSTDIKGIFDRYQQAIGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDGLEFDELRGLEQNVDAALKEVRHRKYHVITTQTETYKKKVKHSYEAYETLQQELGLREEPAFGFVDNTGGGWDGGAGAGAAADMFAFRVVPSQPNLHGMAYGGNHDLRLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry