AibGenesis™ Mouse Anti-MADS4 Antibody (CBMOAB-34584FYB)


Cat: CBMOAB-34584FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34584FYB Monoclonal Rice (Oryza), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice WB, ELISA MO34584FYB 100 µg
MO-AB-01878L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01878L 100 µg
MO-AB-39202W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39202W 100 µg
MO-MMB-0298 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice
CloneMO34584FYB
SpecificityThis antibody binds to Rice MADS4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice MADS4 Antibody is a mouse antibody against MADS4. It can be used for MADS4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMADS-box transcription factor 4; OsMADS4; MADS4; Os05g0423400 LOC_Os05g34940
UniProt IDQ40703
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MGRGKIEIKRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCTPKTTSVFPPLSRILEKYQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLEDEHKMLAFRVHQQEVELSGGIRELELGYHHDDRDFAASMPFTFRVQPSHPNLQQEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry