Mouse Anti-Rice ORC6 Antibody (CBMOAB-41926FYB)


Cat: CBMOAB-41926FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO41926FYB
SpecificityThis antibody binds to Rice ORC6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.
Product OverviewMouse Anti-Rice ORC6 Antibody is a mouse antibody against ORC6. It can be used for ORC6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrigin of replication complex subunit 6; OsORC6; ORC6; LOC_Os07g43540 Os07g0628600
UniProt IDQ8GSL4
Protein RefseqThe length of the protein is 295 amino acids long.
The sequence is show below: MDMSSIASRLGLSGSRPVVRKAAELRRLCDVTFDSSVLGIGEVCKAIICLEIAASKFQVIFDRAEAVRMSGMSEKAYIRSFNALQNGLGVKTTLDVRELGIQFGCVRLIPFVQKGLSLYKERFLAALPPSRRASTDFGRPVFTAAAFYLCAKRHKLKVDKLKLIDLCGTSSSEFTTVSTSMADLCFDVFGIAKEKKDAKSIKGSRELLDVLPSKRKHDDDSDSSGESSGDDQDELDLPTYKRHKKMEKEAYNDWKSSVLSNKQTKPDPAKPRKQAQLNFKKKPSDMALEVSSAAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry