AibGenesis™ Mouse Anti-Rice OSH1 Antibody (CBMOAB-56676FYB)


Cat: CBMOAB-56676FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO56676FYB
SpecificityThis antibody binds to Rice OSH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription factor that regulates genes involved in development. May be involved in shoot formation during embryogenesis. Overexpression in transgenic plants causes altered leaf morphology (PubMed:10488233, PubMed:8755613, PubMed:9869405). Regulates anther dehiscence via direct repression of the auxin biosynthetic gene YUCCA4 (PubMed:29915329). Binds to the DNA sequence 5'-TGAC-3' in the promoter of the YUCCA4 gene and represses its activity during anther development (PubMed:29915329). Reduction of auxin levels at late stage of anther development, after meiosis of microspore mother cells, is necessary for normal anther dehiscence and seed setting (PubMed:29915329). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice OSH1 Antibody is a mouse antibody against OSH1. It can be used for OSH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein knotted-1-like 6; Homeobox protein OSH1; Homeobox protein knotted-1-like 1; Oskn1; OSH1; Os03g0727000 LOC_Os03g51690
UniProt IDP46609
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MEEISHHFGVVGASGVHGGHQHQHHHHPWGSSLSAIVAPPPPPQLQQQQTQAGGMAHTPLTLNTAAAAVGNPVLQLANGSLLDACGKAKEASASASYAADVEAIKAKIISHPHYSSLLAAYLDCQKVGAPPEVAARLTAVAQDLELRQRTALGVLGAATEPELDQFMEAYHEMLVKYREELTRPLQEAMEFLRRVETQLNTLSISGRSLRNILSSGSSEEDQEGSGGETELPEIDAHGVDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKDARQQLLNWWELHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRHWKPSDEMQFVMMDGYHPTNAAAFYMDGHFINDGGLYRLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry