Mouse Anti-Rice rpl23 Antibody (CBMOAB-89163FYB)


Cat: CBMOAB-89163FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO89163FYB
SpecificityThis antibody binds to Rice rpl23.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL17 because the encoded protein shares amino acid identity with ribosomal protein L17 from Saccharomyces cerevisiae; however, its official symbol is RPL23. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-Rice rpl23 Antibody is a mouse antibody against rpl23. It can be used for rpl23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names50S ribosomal protein L23, chloroplastic; rpl23
UniProt IDE9KIS2
Protein RefseqThe length of the protein is 93 amino acids long.
The sequence is show below: MDGIKYAVFTEKSLRLLGKNQYTFNVESGFTKTEIKHWVELFFGVKVVAVNSHRLPGKGRRMGPILGHTMHYRRMIITLQPGYSIPLLDREKN.
See other products for " rpl23 "
MO-AB-36595WMouse Anti-French-bean rpl23 Antibody (MO-AB-36595W)
MO-AB-28604HMouse Anti-Rat Rpl23 Antibody (MO-AB-28604H)
MO-AB-28019WMouse Anti-Cottonwood rpl23 Antibody (MO-AB-28019W)
CBMOAB-09299HCBMouse Anti-C. elegans RPL23 Antibody (CBMOAB-09299HCB)
MO-AB-33135WMouse Anti-Dog RPL23 Antibody (MO-AB-33135W)
MO-AB-07234HMouse Anti-Frog rpl23 Antibody (MO-AB-07234H)
CBMOAB-29980FYAMouse Anti-D. melanogaster Rpl23 Antibody (CBMOAB-29980FYA)
MO-AB-70308WMouse Anti-Silkworm RpL23 Antibody (MO-AB-70308W)
MO-AB-00545WMouse Anti-Barrel medic rpl23 Antibody (MO-AB-00545W)
MO-AB-30509HMouse Anti-Sugar beet rpl23 Antibody (MO-AB-30509H)
For Research Use Only | Not For Clinical Use.
Online Inquiry