Mouse Anti-Rice RPN2 Antibody (CBMOAB-89188FYB)


Cat: CBMOAB-89188FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO89188FYB
SpecificityThis antibody binds to Rice RPN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Vacuole; Endoplasmic reticulum; Mitochondrion; Other locations; Plasma Membrane; Cell Wall

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser / Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rice RPN2 Antibody is a mouse antibody against RPN2. It can be used for RPN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; EC 2.4.99.18; Ribophorin II; RPN-II; Ribophorin-2; RPN2; Os01g0911200 LOC_Os01g68324
UniProt IDQ5N7W3
Protein RefseqThe length of the protein is 698 amino acids long.
The sequence is show below: MAAAGGLPASATLLLLVIAAVAVAPLASAVRPVSDAHRSAAAELFAASPDGSFGDLETTYEAVRTFQILGVEKDKGLIGKACKFAAEKLASSSSSPAKDLFHAARISGVLKCSVDSGVYDDVATRLKAVIKDTNSLLELYYSVGGLLSIKEQGHNVVLPDADNTFHAIKALSQSDGRWRYDTNSAESSTFAAGIALEALSAVISLADSEVDSSMIAVVKNDIVKLFDTIKSYDDGTFYFDEKHVDAAEYKGPITTSASVVRGVTSFAAVASGKLNIPGEKILGLAKFFLGIGLPGSAKDCFNQIESLSFLENNRVFVPLVLSLPSKVFSLTSKDQLKVEVTTVFGSAAPPLRVNLVQVLGSDSKVITTETKELQFDLDNNVHYLDIAPLKIDVGKYSLVFEISLQEQEHETIYATGGTNTEAIFVTGLIKVDKAEIGISDNDAGTVESVQKIDLQKDTSVSLSANHLQKLRLSFQLSTPLGKTFKPHQVFLKLKHDESKVEHLFVVPGSARQFKIVLDFLGLVEKFYYLSGRYDLELAVGDAAMENSFLRALGHIELDLPEAPEKAPKPPAQAVDPFSKFGPKKEISHIFRSPEKRPPKELSFAFTGLTLLPIVGFLIGLMRLGVNLKNFPSLPAPAAFASLFHAGIGAVLLLYVLFWIKLDLFTTLKYLSFLGVFLVFVGHRALSYLSSTSAKQKTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry