Mouse Anti-RIP1 Antibody (CBMOAB-03398CR)
Cat: CBMOAB-03398CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-03398CR | Monoclonal | Yeast, Barrel medic (Medicago truncatula), Rice (Oryza) | WB, ELISA | MO03398CR | 100 µg | ||
| CBMOAB-89102FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89102FYB | 100 µg | ||
| MO-AB-00540W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00540W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Barrel medic (Medicago truncatula), Rice (Oryza) |
| Clone | MO03398CR |
| Specificity | This antibody binds to Yeast RIP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c (Probable). The Rieske protein is a catalytic core subunit containing a [2Fe-2S] iron-sulfur cluster (PubMed:18390544). It cycles between 2 conformational states during catalysis to transfer electrons from the quinol bound in the Q site in cytochrome b (COB) to cytochrome c1 (CYT1) (PubMed:1657998, PubMed:2538628) (Probable). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast RIP1 Antibody is a mouse antibody against RIP1. It can be used for RIP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome b-c1 complex subunit Rieske, mitochondrial; EC 1.10.2.2; Complex III subunit 5; Rieske iron-sulfur protein; RISP; Ubiquinol-cytochrome c reductase iron-sulfur subunit; RIP1; YEL024W |
| UniProt ID | P08067 |
| Protein Refseq | The length of the protein is 215 amino acids long. The sequence is show below: MLGIRSSVKTCFKPMSLTSKRLISQSLLASKSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry