Mouse Anti-RIPPLY1 Antibody (CBMOAB-56544FYA)


Cat: CBMOAB-56544FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56544FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO56544FYA 100 µg
CBMOAB-96041FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96041FYA 100 µg
MO-AB-05680W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05680W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO56544FYA
SpecificityThis antibody binds to Rhesus RIPPLY1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein similar to a zebrafish protein which acts as a transcriptional repressor in and is required for somite segmentation in zebrafish embryos (PMID: 16326386). Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus RIPPLY1 Antibody is a mouse antibody against RIPPLY1. It can be used for RIPPLY1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRIPPLY1
UniProt IDF7EFH4
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: SPPGSGPLRMDSAACVAAATPVPALALALAPDLAQAPLALPGLLSPSPLLSSGKEVDGSERGTCLWRPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSHSFDYLYSAGEILLQNFPVQATINLYEDSDNEEEEEDEEEEDEEEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry